Updated August 2026
LL-37 Dosage: Human Trial Protocols, Research Dosing, and Reconstitution
Research status: LL-37 is the 37-amino-acid human cathelicidin host-defense peptide cleaved from hCAP18/CAMP. Human studies have used topical LL-37 on chronic wounds and intratumoral LL-37 in a four-participant melanoma trial. There is no established subcutaneous dose — commonly discussed 50–400 mcg injection schedules come from community practice.
The best-defined human protocol is topical, not subcutaneous. Venous-leg-ulcer studies applied 0.5, 1.6, or 3.2 mg/mL LL-37 at 25 µL per cm² — equal to 12.5, 40, and 80 mcg/cm² per application, usually twice weekly.
The early trial found the strongest signal at 0.5 mg/mL; 3.2 mg/mL did not improve healing versus placebo. The larger Phase IIb trial was negative overall, with a benefit only in a post-hoc subgroup with ulcers ≥10 cm².
Community SC schedules most often report 100–200 mcg once daily, five days on/two off, for two to four weeks — anecdotal, without human PK or dose-finding support. For a 5 mg vial at 2 mL, each U-100 unit contains 25 mcg (100 mcg = 4 units; 200 mcg = 8 units).
LL-37 dosage in 30 seconds
| Question | Evidence-based answer |
|---|---|
| Full name | Cathelicidin antimicrobial peptide LL-37 |
| Biological source | Mature C-terminal peptide from human hCAP18/CAMP |
| Sequence | [LL-37, 37 aa] |
| Length / mass | 37 amino acids · ~4,493 Da |
| Published human routes | Topical wound; intratumoral injection |
| Published human SC dose | None established |
| Best topical dose | 0.5 mg/mL at 25 µL/cm² = 12.5 mcg/cm² per application |
| Community SC range | Most often 100–200 mcg once daily; wider 50–400 mcg |
| Human SC half-life | Not established |
| Main dosing lesson | Route and local concentration dominate; response can be non-linear |
- Best-characterized human route: topical wound application — not SC
- Topical VLU dose: 0.5 / 1.6 / 3.2 mg/mL at 25 µL/cm² = 12.5 / 40 / 80 mcg/cm², twice weekly
- Strongest early signal: 0.5 mg/mL; 3.2 mg/mL showed no benefit vs placebo in Phase I/II
- Phase IIb (HEAL): negative overall; post-hoc ≥10 cm² subgroup only
- DFU trial: 0.5 mg/mL cream twice weekly × 4 weeks — improved granulation, not bacterial clearance
- Melanoma NCT02225366: 250 mcg per tumor weekly × 8 weeks (n=4); lichenoid toxicity case
- No published human SC dose — community range most often 100–200 mcg daily
- Non-linear dose-response: higher topical concentration ≠ reliably better
What is LL-37?
LL-37 is the mature, biologically active C-terminal fragment of human cationic antimicrobial protein 18 (hCAP18). The human CAMP gene encodes the larger preproprotein; proteolytic processing releases the 37-residue peptide beginning with two leucines. It is found in neutrophils and produced by epithelial cells, macrophages, and other barrier-surface cells. ([UniProt CAMP](https://www.uniprot.org/uniprotkb/P49913/entry))
In water and biological membranes, LL-37 can adopt an amphipathic alpha-helical structure. Its net positive charge and hydrophobic face allow association with negatively charged microbial membranes — helping explain antibacterial, antifungal, antiviral, and antibiofilm findings in laboratory systems. Physiological salt, serum proteins, proteases, and local lipid environment can substantially change that activity.
LL-37 is also a host-defense signaling peptide. Depending on concentration and context, it can recruit immune cells, influence neutrophil survival, activate or dampen Toll-like-receptor signaling, promote endothelial and epithelial responses, and bind extracellular DNA or RNA. The same molecule can appear antimicrobial in one experiment, pro-healing in another, and pro-inflammatory or cytotoxic in a third.
Identity and naming checks
Several related names are not interchangeable. Confirm the vial contains full-length unmodified LL-37 before comparing with any protocol — especially CRAMP, KR-12, and OP-145/P60.4Ac.
Identity gate
Confirm LL-37 vs hCAP18, CRAMP, KR-12, OP-145, or analogues
Incomplete — confirm identity before trusting protocols
Names such as cathelicidin, hCAP18 fragment, or antimicrobial peptide do not establish whether the vial contains full-length LL-37, a fragment, an analogue, or a salt form. Analytics should resolve identity first.
Name vs identity — can its dose be reused for LL-37?
| Name | Identity | Reusable for LL-37? |
|---|---|---|
| LL-37 | Mature 37-residue human cathelicidin | This page's subject |
| Ropocamptide | Development name for synthetic LL-37 in wound research | Yes only when confirmed unmodified LL-37 |
| hCAP18 / CAMP precursor | Larger precursor cleaved to release LL-37 | No |
| FALL-39 | Historically proposed 39-residue form | No — length differs |
| CRAMP / mCRAMP | Murine cathelicidin | No — mouse molecule |
| KR-12 | LL-37 fragment residues 18–29 | No — different length and activity |
| OP-145 / P60.4Ac | LL-37-derived peptide | No — derivative, not LL-37 |
| SAAP-148 and analogues | Engineered peptides inspired by LL-37 | No |
Product and assay checks
| Test | What it answers |
|---|---|
| Intact-mass spectrometry | Principal molecule matches full-length LL-37? |
| Peptide mapping / sequence confirmation | All 37 residues present in correct order? |
| Quantitative peptide assay | Milligrams of LL-37 active moiety actually present? |
| Counterion, water, residual-solvent testing | Does labeled mass include acetate, TFA, or synthesis residues? |
| Related-substance analysis | Truncations, aggregates, oxidized species present? |
| Endotoxin, sterility, particulate testing | Lot suitable for proposed laboratory route? |
| Vehicle-specific stability | Material remains soluble, potent, and microbiologically controlled? |
| Adsorption/recovery study | Peptide lost to glass, plastic, filters, or tubing? |
An HPLC result labeled “99% pure” does not by itself establish amount, identity, sterility, aggregation state, or usable shelf life. LL-37's amphipathic, cationic character makes formulation unusually important.
Current research and compounding status
LL-37 has no U.S. prescribing label or standardized clinical dosage. FDA's compounding safety page identifies concerns about immunogenicity, peptide-related impurities, active-ingredient characterization, limited human safety information, male reproductive findings in nonclinical research, and context-dependent protumor effects. A Pharmacy Compounding Advisory Committee discussion of LL-37 for possible inclusion on the section 503A bulks list is expected before the end of February 2027. ([FDA safety-risk page](https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks))
A future PCAC recommendation would concern compounding policy — not validate an indication or dose. Human evidence remains route-specific and concentrated in topical wound studies.
Dosage used in human clinical trials
These are experimental doses from supervised clinical programs — not interchangeable treatment instructions. Wound studies used proprietary PVA solution or cream vehicles plus standard wound care. The melanoma trial used direct tumor injection by oncology investigators. Neither route defines an SC dose.
Human trial evidence
Topical wound RCTs + intratumoral melanoma (n=4) — no SC human dose
Human RCT
0.5, 1.6, or 3.2 mg/mL · 25 µL/cm²
Surface dose: 12.5, 40, or 80 mcg/cm²
- Frequency / route
- Topical to ulcer, twice weekly
- Duration
- 4 weeks (+ 3-week placebo run-in)
- Population
- 34 adults, hard-to-heal venous leg ulcers
- Main result
- 0.5 mg/mL strongest signal; 3.2 mg/mL did not improve healing vs placebo
| Human-evidence question | Finding |
|---|---|
| Published human topical wound dose | 0.5–3.2 mg/mL at 25 µL/cm² |
| Best-characterized topical exposure | 0.5 mg/mL = 12.5 mcg/cm² per application |
| Published human SC dose | None established |
| Published human SC pharmacokinetics | None identified |
| Human half-life after SC injection | Not established |
| Maximum tolerated SC dose | Not established |
| Weight-based human SC dose | Not established |
| Community SC range | Most often 100–200 mcg daily; wider 50–400 mcg |
Human trial summary
| Study | Dose | Frequency / route | Duration | Main result |
|---|---|---|---|---|
| Grönberg et al., 2014 | 0.5 / 1.6 / 3.2 mg/mL · 25 µL/cm² | Topical, twice weekly | 4 weeks | 0.5 mg/mL strongest signal; 3.2 mg/mL no benefit vs placebo |
| HEAL Phase IIb, 2021 | 0.5 / 1.6 mg/mL · 25 µL/cm² | Topical + compression, twice weekly | 13 weeks | Negative overall; post-hoc ≥10 cm² subgroup signal |
| Miranda et al., 2023 | 0.5 mg/mL cream | Topical DFU, twice weekly | 4 weeks | Improved granulation; no significant bacterial or cytokine reduction |
| NCT02225366 | 250 mcg per tumor | Intratumoral, once weekly | 8 weeks | n=4; lichenoid dermatologic toxicity case published |
First-in-human venous-leg-ulcer protocol
The 2014 randomized, placebo-controlled study enrolled 34 people with hard-to-heal venous leg ulcers. Everyone completed a three-week open-label placebo run-in, then received LL-37 in 10.5% polyvinyl-alcohol viscous solution or placebo twice weekly for four weeks.
Application amount was 25 µL per cm² of wound area. The 0.5 and 1.6 mg/mL groups had mean ulcer-area reductions of 68% and 50%, respectively — 0.5 mg/mL statistically significant on healing-rate analysis. The 3.2 mg/mL arm showed no healing advantage over placebo — an important non-linear dose-response warning. ([Grönberg et al., 2014](https://pubmed.ncbi.nlm.nih.gov/25041740/))
Wound-area calculator
Trial exposure: area × 0.025 mL/cm² × concentration → mcg per application
Trial concentration arm
Application volume: 0.250 mL (10 cm² × 0.025 mL/cm²)
125.0 mcg LL-37 per application
= 0.1250 mg · 12.5 mcg/cm² at 0.5 mg/mL
Eight twice-weekly applications (4 weeks, constant area): ≈ 1000 mcg/cm² cumulative (1.00 mg/cm²)
Reconstructs published trial PVA exposure — not a home wound-care recipe. Trial vehicle, aseptic preparation, compression, and monitoring are part of the intervention.
Phase IIb HEAL LL-37 protocol
The multicenter trial used three-week placebo run-in, randomization to 0.5 mg/mL, 1.6 mg/mL, or placebo, product at 25 µL/cm² twice weekly for 13 weeks with compression therapy, and 16-week follow-up.
Nominal active doses were again 12.5 or 40 mcg/cm² per application. In the full population, neither concentration significantly improved healing versus placebo. In a post-hoc analysis of ulcers ≥10 cm², 28.1% of the 0.5 mg/mL group achieved confirmed complete closure vs 8.1% placebo — hypothesis-generating, not confirmation the trial succeeded overall. ([Mahlapuu et al., 2021](https://pubmed.ncbi.nlm.nih.gov/34687253/))
Diabetic-foot-ulcer cream protocol
The 2023 double-blind trial randomized 25 participants to 0.5 mg/mL LL-37 cream or placebo, applied twice weekly for four weeks with standard DFU care. Granulation index increased at days 7, 14, 21, and 28. IL-1-alpha, TNF-alpha, and aerobic bacterial colonization did not significantly improve. ([Miranda et al., 2023](https://pubmed.ncbi.nlm.nih.gov/37480520/))
This supports further study of this exact cream, population, route, and schedule — not that injected LL-37 treats diabetic foot infection.
Intratumoral melanoma protocol
The completed Phase I study [NCT02225366](https://clinicaltrials.gov/study/NCT02225366) enrolled four participants. Registry describes direct injection into two to four cutaneous tumors once weekly for eight weeks at 250 mcg per tumor injection.
A published participant report described verrucous papules and erythematous plaques with lichenoid clinicopathologic features — confirming local administration can produce clinically important cutaneous immune toxicity. This is not evidence for SC injection near infection, wounds, or suspected tumors. ([Dolkar et al., 2018](https://pubmed.ncbi.nlm.nih.gov/29665030/))
LL-37 research dosage
The table below documents human trial exposures and commonly reported community SC protocols. Repetition documents convention; it does not identify pharmacokinetic rationale or establish safety.
Commonly reported research protocols
| Research protocol | Reported amount | Frequency | Route | Duration | Evidence classification |
|---|---|---|---|---|---|
| VLU clinical low concentration | 12.5 mcg/cm² per application | Twice weekly | Topical PVA solution | 4 or 13 weeks | Human clinical evidence |
| VLU clinical intermediate | 40 mcg/cm² per application | Twice weekly | Topical PVA solution | 4 or 13 weeks | Human clinical evidence |
| VLU clinical high concentration | 80 mcg/cm² per application | Twice weekly | Topical PVA solution | 4 weeks | Human clinical evidence; no efficacy advantage |
| DFU clinical cream | 0.5 mg/mL cream | Twice weekly | Topical cream | 4 weeks | Small human clinical trial |
| Melanoma trial | 250 mcg per tumor injection | Once weekly into 2–4 tumors | Intratumoral | 8 weeks | Very small Phase I (n=4) |
| Community core SC protocol | 100–200 mcg | Once daily, often 5 on/2 off | SC | Commonly 2–4 weeks | Anecdotal community convention |
| Community extended SC | 200–400 mcg | Daily or 5 on/2 off | SC | Often 4–8 weeks; some extend to 12 | Insufficient evidence |
Human evidence supports only narrow, route-specific conclusions. Claims that SC injection targets a nearby wound, gut segment, biofilm, Lyme infection, or tumor are not validated by these studies.
Complete community-anchored 6-week LL-37 research protocol
The most interpretable way to examine the dominant community schedule is a prospective, fixed-exposure observational design — not a published clinical protocol or treatment recommendation. Two fixed groups (100 mcg or 200 mcg SC once daily, five days per week for four weeks) avoid an unvalidated escalation ladder, followed by two weeks without exposure.
6-week observational protocol
Fixed 100 mcg vs 200 mcg SC · 5 on/2 off × 4 weeks + 2-week washout
Days 1–28
100 mcg
Once daily · SC · 5 days on / 2 off
Fixed lower community range — no titration, loading dose, or escalation
Cumulative exposure: 2 mg (20 administrations)
Fixed parallel groups — not titration. Group A = 2 mg total; Group B = 4 mg total over 4 weeks. Observational community-anchored design, not a published clinical protocol.
Research question
Can the two most repeated community exposures be observed with predefined tolerability and exploratory outcomes, followed by two weeks without exposure? Separate fixed groups avoid changing dose, frequency, diet, antimicrobials, supplements, and outcome definitions simultaneously.
Phase 2: fixed exposure, weeks 1–4
Fixed-exposure groups
| Group | Amount | Frequency | Route | Administrations | Four-week total |
|---|---|---|---|---|---|
| A: lower community | 100 mcg | Daily · 5 on/2 off | SC | 20 | 2 mg |
| B: upper community | 200 mcg | Daily · 5 on/2 off | SC | 20 | 4 mg |
Material requirements (mass balance)
| Group | Four-week LL-37 | 5 mg vial need | Nominal unused |
|---|---|---|---|
| A: 100 mcg × 20 | 2 mg | 1 vial | 3 mg |
| B: 200 mcg × 20 | 4 mg | 1 vial | 1 mg |
Predefined hold and stop rules
Stop exposure and obtain urgent medical assessment for: facial/lip/tongue/airway swelling; wheezing; generalized hives; syncope; chest pain; severe shortness of breath; fever with rigors or possible sepsis; spreading painful injection-site reaction; new generalized rash or lichenoid eruption; significant new lab abnormality; visible particles, precipitation, or failed identity/sterility/endotoxin result.
Reported LL-37 dosage range
Dosage range summary
| Category | Reported range or schedule |
|---|---|
| Human topical VLU concentration | 0.5–3.2 mg/mL |
| Human topical VLU surface dose | 12.5–80 mcg/cm² per application |
| Human topical VLU frequency | Twice weekly |
| Human topical VLU duration | 4 weeks (Phase I/II); 13 weeks (Phase IIb) |
| Human DFU cream | 0.5 mg/mL twice weekly × 4 weeks |
| Human intratumoral registry dose | 250 mcg per tumor · weekly × 8 weeks |
| Most repeated community SC | 100–200 mcg once daily |
| Wider community SC range | 50–400 mcg per administration |
| Common community pattern | 5 days on / 2 off for 2–4 weeks |
| Published human SC overlap | None |
| Established weight-based human dose | None |
Anecdotal versus clinically studied dosing
The discrepancy is substantial. Community schedules use a different route, more frequent exposure, and usually a different vehicle than every published human program.
Evidence split
Human topical/intratumoral research vs community SC conventions
Human wound & intratumoral research
Topical RCTs + 4-participant melanoma study
- Dose
- 0.5–3.2 mg/mL; 12.5–80 mcg/cm² topical
- Frequency
- Twice weekly (wound); once weekly (intratumoral)
- Route
- Directly onto measured wound or into 2–4 tumors
- Duration
- 4 or 13 weeks (wound); 8 weeks (melanoma)
- Formulation
- Trial PVA solution or validated cream
- Monitoring
- Wound measurement, standard care, oncology oversight
- Evidence
- RCTs with mixed efficacy; melanoma n=4
Community SC reports
Anecdotal — no human SC trial
- Dose
- Usually 100–200 mcg; wider 50–400 mcg
- Frequency
- Daily or 5 days on / 2 off
- Route
- Subcutaneous depot
- Duration
- Commonly 2–4 weeks; sometimes 8–12
- Formulation
- Reconstituted lyophilized vial in bacteriostatic water
- Monitoring
- Highly variable
- Evidence
- Uncontrolled reports; no human PK study
LL-37 reconstitution and concentration math
For a U-100 syringe, 100 units equal 1 mL. The tables are arithmetic aids for laboratory planning — they do not prescribe a diluent or create evidence that a multidose injectable preparation remains sterile or chemically stable.
5 mg in 2 mL is a commonly highlighted preset: 2.5 mg/mL = 2,500 mcg/mL = 25 mcg per U-100 unit — so 100 mcg = 4 units and 200 mcg = 8 units.
Reconstitution math
5 mg @ 1/2/5 mL + 10 mg/2 mL — vial mg + diluent → mcg and U-100 units
Vial preset
Target amount
5 mg · 2 mL (2.5 mg/mL) · concentration ≈ 2.50 mg/mL · ≈ 25 mcg per U-100 unit
100 mcg = 0.040 mL = 4.0 U-100 units
Highlighted preset: 5 mg/2 mL → 25 mcg/unit · 100 mcg = 4 units · 200 mcg = 8 units
Calculation reference only — not a formulation recipe. LL-37 can aggregate and adsorb to surfaces. Trial PVA/cream stability ≠ bacteriostatic water 28-day BUD.
5 mg vial at 2 mL final volume (highlighted preset)
| Target amount | Volume | U-100 units |
|---|---|---|
| 50 mcg | 0.02 mL | 2 units |
| 100 mcg | 0.04 mL | 4 units |
| 150 mcg | 0.06 mL | 6 units |
| 200 mcg | 0.08 mL | 8 units |
| 250 mcg | 0.10 mL | 10 units |
| 300 mcg | 0.12 mL | 12 units |
| 400 mcg | 0.16 mL | 16 units |
LL-37 can self-associate, bind to surfaces, undergo proteolysis, and lose recoverable concentration through adsorption. Published wound PVA solution and DFU cream stability do not establish that LL-37 in bacteriostatic water remains suitable for injection for 28 days.
Why LL-37 responses can be non-linear
At sufficient local concentrations, LL-37 can disrupt lipid bilayers — moving from signaling toward host-cell toxicity, hemolysis, or intense inflammation. Serum, salt, and proteins change activity; proteases shorten local persistence; and signaling can reverse with context.
The 2014 wound trial's lowest concentration outperforming the highest is consistent with a concentration-dependent optimum rather than a monotonic dose-response.
Myth / claim checker
SC-as-topical, higher-is-better, antibiotic substitute, CRAMP transfer, and Herx claims
Topical exposure is per cm² of wound surface in a specific vehicle. A 100 mcg SC injection creates a systemic depot with different geometry, absorption, and free concentration. The units are not interchangeable.
Preclinical LL-37 dosage
Selected preclinical exposures — not human SC doses
| Model | Exposure | Route / schedule | Why not a human dose |
|---|---|---|---|
| Dexamethasone-impaired mouse wounds | 10 mcg in 50 µL per application | Topical, twice daily × 7 days | Local murine wound model; no human systemic PK |
| Cecal-ligation sepsis mice | 2 mcg per mouse | Single IV after CLP | Acute lethal model; IV route; mouse biology |
| MRSA surgical-wound mice | 1 mg/kg LL-37 | Topical and/or IP; daily systemic | Infected surgical model; animal routes |
| Gram-negative sepsis rats | 1 mg/kg | IV in sepsis protocol | Rat sepsis exposure not convertible to community SC |
Mouse CRAMP studies should be listed as related cathelicidin research, not LL-37 dosing. Encapsulated hydrogels, gene-transfected cells, and nanoparticle delivery change local retention and cannot be pooled with free peptide.
How LL-37 may work
- Direct microbial membrane disruption — cationic amphipathic structure promotes binding to negatively charged microbial surfaces. Affects some biofilms in vitro; does not replace pathogen identification and approved antimicrobial therapy.
- Chemotaxis and innate immune signaling — pathways involving FPR2/FPRL1, P2X7, EGFR transactivation, and Toll-like receptors. Influences neutrophils, monocytes, T cells, dendritic cells, keratinocytes, and endothelial cells.
- Wound repair and angiogenesis — promotes keratinocyte migration, epithelial repair, and endothelial responses. Topical development aimed to restore local exposure in chronic wounds with little recoverable endogenous LL-37 at the edge.
- Nucleic-acid sensing and inflammatory skin disease — can form complexes with self-DNA/RNA and activate plasmacytoid dendritic cells. Excess or altered LL-37 participates in psoriasis and rosacea pathology.
- Context-dependent cancer biology — anticancer and growth-promoting effects in different models. It is inaccurate to call LL-37 a general anticancer peptide.
What results have actually been shown?
Chronic wounds
Early venous-ulcer study produced a promising signal at 0.5 mg/mL, but Phase IIb did not confirm benefit in the overall cohort. Post-hoc large-ulcer subgroup requires prospective confirmation. DFU cream improved granulation in 25 participants without significantly reducing bacterial colonization.
Infection and biofilms
LL-37 kills or inhibits multiple pathogens in experimental systems. Human trials have not established an SC regimen for Lyme disease, mold illness, Candida overgrowth, or nonspecific chronic infection.
Cancer
The four-participant melanoma study is an early safety and biological-activity experiment, not proof of cancer efficacy. Mixed preclinical literature and published dermatologic toxicity make unsupervised tumor-directed use especially inappropriate.
Expected timeline in research
Reasonable observation windows by endpoint
| Endpoint | Earliest reasonable window | Evidence source |
|---|---|---|
| Immediate local reaction | Minutes to 24 hours | Injection or topical tolerability monitoring |
| Delayed rash or immune skin reaction | Days to weeks | Mechanism and melanoma case report |
| Wound-area or granulation change | Weekly over 4–13 weeks | Human wound trials |
| Microbial culture change | Defined sampling days | Clinical microbiology protocol |
| Durable wound closure | Repeated visits and follow-up | Human wound-trial design |
| Community SC exploratory signal | Unknown | No controlled human SC data |
LL-37 dosage evidence ladder
Topical LL-37 dosing is partially characterized — concentration, wound surface dose, frequency, duration, and tolerability have been studied in humans. Efficacy remains uncertain after a negative overall Phase IIb result. Subcutaneous dosing is unestablished.
Dosage evidence ladder
Topical human trials exist — SC dosing is unestablished
| Evidence level | LL-37 evidence | Confidence |
|---|---|---|
| Established prescribing dosage | None | None |
| Human randomized topical wound trials | Three studies using 0.5–3.2 mg/mL | Moderate for feasibility; mixed for efficacy |
| Human intratumoral trial | Four participants, weekly tumor injection | Very low for efficacy or general safety |
| Human SC dosing | No controlled dose-finding, PK, or efficacy study | None established |
| Animal wound, sepsis, infection models | Multiple preclinical studies | Mechanistic only; route- and species-specific |
| Community SC 100–200 mcg daily | Repeated anecdotal convention | Very low; no validated therapeutic window |
| Extended community SC 200–400 mcg | Less consistent online reports | Insufficient evidence |
Safety and adverse effects
Topical venous-ulcer trials reported studied concentrations were generally well tolerated in controlled wound-care settings — limited to those products, routes, eligibility criteria, and monitoring. That reassurance does not establish safety of repeated SC exposure.
Seek urgent evaluation for fever with confusion, rapidly spreading redness, severe wound pain, chest pain, breathing difficulty, facial swelling, or suspected sepsis. LL-37 should never delay antibiotics, surgical source control, vascular assessment, cancer biopsy, or emergency treatment.
Safety findings
Topical trial tolerability, lichenoid toxicity, SC uncertainty, and product-quality risks
| Topic | Status | Note |
|---|---|---|
| Topical wound trial tolerability | Generally well tolerated in trial settings | Limited to studied concentrations, vehicles, and eligibility criteria |
| Intratumoral lichenoid toxicity | Published case report | Verrucous papules and erythematous plaques during melanoma trial |
| Repeated SC exposure | Not established | No controlled human SC safety or incidence data |
| Inflammatory skin disease | Biologically plausible risk | LL-37 participates in psoriasis and rosacea pathways — safety not established |
| Product-quality risk | Elevated | Aggregation, adsorption, impurities, and formulation instability can dominate risk |
Storage and stability
Storage instructions must follow lot-specific analytical data. A 2021 study found 0.5 mg/mL LL-37 cream chemically stable in its specific oil-in-water emulsion — that result cannot be generalized to reconstituted powder, bacteriostatic water, saline, or multidose injection vials.
Research handling principles
| Material state | Handling principle |
|---|---|
| Unopened lyophilized material | Protect from moisture and light; use manufacturer's validated temperature and retest date |
| Prepared analytical stock | Low-binding materials when validated; minimize freeze-thaw cycles |
| Injectable research preparation | Require stability for exact diluent, concentration, container, and temperature |
| Topical PVA solution | Do not substitute for published trial concentrate-and-diluent process |
| 0.5 mg/mL cream | Formulation-specific stability — does not apply to aqueous vials |
Avoid automatically assigning a 28-day refrigerated beyond-use period without validated chemical, physical, and microbiological stability evidence.
Anti-doping status
LL-37 is not known for a peptide-specific named entry on the 2026 WADA list. However, WADA's S0 Non-Approved Substances category prohibits pharmacological substances without current approval for human therapeutic use at all times. Competitive athletes should obtain a case-specific determination before exposure. ([2026 WADA Prohibited List](https://www.wada-ama.org/sites/default/files/2025-09/2026list_en_final_clean_september_2025.pdf))
Bottom line
LL-37 has more human dose information than many research peptides, but almost all of it is topical and wound-specific. The most reproducible human exposure is 0.5 mg/mL at 25 µL/cm² twice weekly (12.5 mcg/cm² per application). Even that dose has mixed efficacy evidence.
Daily SC schedules of 100–200 mcg are community conventions without human pharmacokinetic or dose-finding support. A complete research protocol should keep route, concentration, formulation, product quality, monitoring, and stop rules explicit — and should never convert topical, intratumoral, or animal exposures into a general therapeutic dose.
Confirm full-length LL-37 identity (≠ CRAMP, KR-12, OP-145). Topical trial vehicles ≠ bacteriostatic water recon. Higher concentration ≠ reliably better.
Frequently asked questions
What is the most commonly reported LL-37 dose?
Community SC sources most often report 100–200 mcg once daily, frequently five days per week for two to four weeks. This is an anecdotal convention, not a dose validated in human SC trials.
What dose of LL-37 was used in human wound trials?
Venous-leg-ulcer trials used 0.5, 1.6, or 3.2 mg/mL at 25 microliters per cm² of wound area — equal to 12.5, 40, or 80 mcg/cm² per application, usually applied twice weekly.
Which topical LL-37 dose worked best?
The 0.5 mg/mL concentration produced the strongest signal in the early venous-ulcer trial. The larger Phase IIb study found no significant benefit in the overall population; a post-hoc large-ulcer subgroup favored 0.5 mg/mL. Higher concentration was not reliably better.
What was the LL-37 diabetic-foot-ulcer dose?
The small randomized trial used 0.5 mg/mL LL-37 cream twice weekly for four weeks with standard care. Granulation improved, but inflammatory cytokines and aerobic bacterial colonization did not significantly improve.
Is 100 mcg of LL-37 a clinical dose?
No. A 100 mcg SC amount is commonly discussed in community protocols, but no published human SC dose-finding study has established it as effective or safe.
What is a conservative LL-37 research protocol?
A conservative observational design fixes exposure at 100 mcg SC once daily, five days per week for four weeks, then observes for two weeks without exposure. It requires medical oversight, verified sterile material, baseline testing, predefined endpoints, and stop rules. It remains a community-anchored experiment, not a clinical recommendation.
Does LL-37 require dose escalation?
No human SC evidence supports escalation. The human wound data warn against assuming more is better: 3.2 mg/mL did not improve healing in the early trial.
Does LL-37 require a loading dose or taper?
No published human evidence establishes a loading dose or taper for topical, intratumoral, or SC LL-37.
How long is LL-37 commonly used?
Community SC schedules often last two to four weeks, with some extending to eight or twelve weeks. Human topical trials used four or thirteen weeks. Duration cannot be transferred across routes.
How much LL-37 is needed for four weeks?
At 100 mcg five days per week for four weeks, the theoretical total is 2 mg. At 200 mcg on the same schedule, it is 4 mg. These are inventory calculations, not recommended exposures.
How many U-100 units is 100 mcg from a 5 mg vial?
It depends on final volume. At 5 mg in 1 mL, 100 mcg is 2 units. At 5 mg in 2 mL, it is 4 units. At 5 mg in 5 mL, it is 10 units.
How many U-100 units is 200 mcg from a 5 mg vial?
At 5 mg in 1 mL, 200 mcg is 4 units. At 5 mg in 2 mL, it is 8 units. At 5 mg in 5 mL, it is 20 units.
Is one U-100 unit a fixed LL-37 dose?
No. One unit is a volume of 0.01 mL. The LL-37 amount depends on the vial mass and final concentration.
Can a 5 mg LL-37 vial be mixed to 1 mg/mL?
The arithmetic requires a 5 mL final volume. That may not fit the vial, and arithmetic alone does not establish solubility, stability, compatibility, or sterility.
How long does reconstituted LL-37 last?
No universal shelf life is established for community aqueous preparations. A discard date requires stability and microbiological data for the exact formulation, container, concentration, and temperature. Published cream stability cannot be assigned to a vial in bacteriostatic water.
What is LL-37's half-life?
A clinically useful human half-life after SC injection has not been established. Proteolysis, tissue binding, serum binding, aggregation, and route can all change apparent persistence.
Is LL-37 an antibiotic?
LL-37 is an endogenous host-defense peptide with direct antimicrobial activity in many laboratory systems. It is not a substitute for a diagnosed-infection treatment plan, cultures, source control, or approved antimicrobial drugs.
Does LL-37 kill biofilms?
LL-37 can inhibit or disrupt selected biofilms in vitro. Human trials have not established an SC dose that eradicates clinical biofilm disease.
Does LL-37 treat Lyme disease, mold illness, or Candida?
No controlled human trial establishes LL-37 dosing or efficacy for those conditions. Testing and treatment should follow diagnosis-specific clinical standards.
Can LL-37 be injected near a wound or infection?
Human wound evidence used direct topical application in a measured, cleansed wound with a trial-specific vehicle and standard care. It does not validate SC injection near a wound, abscess, or infection.
Can LL-37 be injected into a tumor?
Direct tumor injection was studied only in a specialized four-participant melanoma trial with biopsies, imaging, oncology oversight, and published skin toxicity. It is not a general or self-directed cancer protocol.
Does LL-37 cause a Herxheimer reaction?
There is no validated LL-37-specific die-off syndrome. Fever, rash, hypotension, breathing difficulty, or worsening illness should be evaluated as a possible adverse event or infection complication.
Can redness after LL-37 be considered normal?
Mild transient local redness may occur, but redness is still an adverse-event observation. Spreading, painful, hot, persistent, blistering, draining, or necrotic change requires stopping exposure and medical evaluation.
Can LL-37 worsen psoriasis or rosacea?
It is biologically plausible. LL-37 participates in self-nucleic-acid sensing in psoriasis and is abnormally processed in rosacea. Safety in people with active inflammatory skin disease has not been established.
Is LL-37 safe for people with cancer?
That is unknown and may depend on tumor type. LL-37 has shown both antitumor and protumor effects in research. People with known or suspected cancer should not use it outside qualified oncology research.
Can LL-37 be combined with KPV, BPC-157, TB-500, or GHK-Cu?
No controlled human study establishes a dose, interaction profile, or safety advantage for those combinations. A multi-peptide stack also makes it difficult to identify the cause of an adverse event or outcome.
Is LL-37 safe for long-term use?
Long-term SC safety is not established. The community's repeated-cycle and maintenance schedules lack controlled human evidence.
Is higher-dose LL-37 more effective?
Not predictably. The early wound trial found the clearest signal at 0.5 mg/mL, while 3.2 mg/mL did not outperform placebo. LL-37 can shift from signaling to inflammatory or cytotoxic effects as local concentration changes.
References
Grönberg A, et al.
Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcersWound Repair Regen. 2014.
Mahlapuu M, et al.
Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: Phase IIb RCTWound Repair Regen. 2021.
Miranda E, et al.
Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcerArch Dermatol Res. 2023.
NCT02225366
Induction of Antitumor Response in Melanoma Patients Using LL37ClinicalTrials.gov.
Dolkar T, et al.
Dermatologic toxicity from novel therapy using antimicrobial peptide LL-37 in melanomaJ Cutan Pathol. 2018.
Heilborn JD, et al.
LL-37 is involved in re-epithelialization of human skin woundsJ Invest Dermatol. 2003.
Ramos R, et al.
Wound healing activity of the human antimicrobial peptide LL37Peptides. 2011.
Hu Z, et al.
Antimicrobial cathelicidin peptide LL-37 inhibits pyroptosis and improves survival in septic miceInt Immunol. 2016.
Lande R, et al.
Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptideNature. 2007.
FDA
Certain Bulk Drug Substances for Use in Compounding that May Present Significant Safety RisksFDA compounding safety page.
World Anti-Doping Agency
2026 Prohibited ListS0 Non-Approved Substances.